Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.11: TM0957-like [141318] (1 family) extra N-terminal region and large insertion after strand 3 together form an alpha-helical subdomain automatically mapped to Pfam PF10054 |
Family b.40.11.1: TM0957-like [141319] (1 protein) |
Protein Hypothetical protein TM0957 [141320] (1 species) |
Species Thermotoga maritima [TaxId:2336] [141321] (1 PDB entry) Uniprot Q9X052 39-214 |
Domain d2f4ia1: 2f4i A:39-214 [132923] complexed with cl, mg |
PDB Entry: 2f4i (more details), 2.25 Å
SCOPe Domain Sequences for d2f4ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f4ia1 b.40.11.1 (A:39-214) Hypothetical protein TM0957 {Thermotoga maritima [TaxId: 2336]} fdpkryarelwfklqdmmneglgydavevlntldenpelahqkfakvvgvsnyryyiiqg vgeiveikddgilvkvrenrkvpdlflsnhifgngivnatgiakmedfdriidfnltate lnkivkeevvnsflkqlskgagsvgslvrfiavftllkdeeikypieaiplyleiq
Timeline for d2f4ia1: