Lineage for d2f4ia1 (2f4i A:39-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668969Superfamily b.40.11: TM0957-like [141318] (1 family) (S)
    extra N-terminal region and large insertion after strand 3 together form an alpha-helical subdomain
  5. 668970Family b.40.11.1: TM0957-like [141319] (1 protein)
  6. 668971Protein Hypothetical protein TM0957 [141320] (1 species)
  7. 668972Species Thermotoga maritima [TaxId:2336] [141321] (1 PDB entry)
  8. 668973Domain d2f4ia1: 2f4i A:39-214 [132923]
    complexed with cl, mg, mly

Details for d2f4ia1

PDB Entry: 2f4i (more details), 2.25 Å

PDB Description: crystal structure of an ob-fold protein (tm0957) from thermotoga maritima msb8 at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein TM0957

SCOP Domain Sequences for d2f4ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ia1 b.40.11.1 (A:39-214) Hypothetical protein TM0957 {Thermotoga maritima [TaxId: 2336]}
fdpkryarelwfklqdmmneglgydavevlntldenpelahqkfakvvgvsnyryyiiqg
vgeiveikddgilvkvrenrkvpdlflsnhifgngivnatgiakmedfdriidfnltate
lnkivkeevvnsflkqlskgagsvgslvrfiavftllkdeeikypieaiplyleiq

SCOP Domain Coordinates for d2f4ia1:

Click to download the PDB-style file with coordinates for d2f4ia1.
(The format of our PDB-style files is described here.)

Timeline for d2f4ia1: