Lineage for d2f4fb1 (2f4f B:2-131)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 726192Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
  5. 726193Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
    Pfam PF01797
  6. 726204Protein Putative transposase SSO1474 [143424] (1 species)
  7. 726205Species Archaeon Sulfolobus solfataricus [TaxId:2287] [143425] (2 PDB entries)
  8. 726209Domain d2f4fb1: 2f4f B:2-131 [132921]
    automatically matched to 2F4F A:2-131
    complexed with mn

Details for d2f4fb1

PDB Entry: 2f4f (more details), 1.8 Å

PDB Description: Crystal structure of IS200 transposase
PDB Compounds: (B:) Transposase, putative

SCOP Domain Sequences for d2f4fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4fb1 d.58.57.1 (B:2-131) Putative transposase SSO1474 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

SCOP Domain Coordinates for d2f4fb1:

Click to download the PDB-style file with coordinates for d2f4fb1.
(The format of our PDB-style files is described here.)

Timeline for d2f4fb1:

Domains from other chains:
(mouse over for more information)
d2f4fa1