SCOPe 2.08: Domain d2f4fb_: 2f4f B:

Lineage for d2f4fb_ (2f4f B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
   automatically mapped to Pfam PF01797

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein automated matches [190624] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187685] (2 PDB entries)

8. Domain d2f4fb_: 2f4f B: [132921]
   Other proteins in same PDB: d2f4fa1
   automated match to d2f4fa1
   complexed with mn

Details for d2f4fb_

PDB Entry: 2f4f, 1.8 Å

PDB Description: Crystal structure of IS200 transposase

PDB Compounds: (B:) Transposase, putative

SCOPe Domain Sequences for d2f4fb_:

Sequence; same for both SEQRES and ATOM records:

>d2f4fb_ d.58.57.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

Timeline for d2f4fb_:

• d2f4fb_ first appeared in SCOP 1.73, called d2f4fb1
  
• d2f4fb_ appears in SCOPe 2.07