Lineage for d2f4fa1 (2f4f A:2-131)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522840Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2522841Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2522862Protein Putative transposase SSO1474 [143424] (1 species)
  7. 2522863Species Sulfolobus solfataricus [TaxId:2287] [143425] (1 PDB entry)
    Uniprot Q97Y68 2-131
  8. 2522864Domain d2f4fa1: 2f4f A:2-131 [132920]
    Other proteins in same PDB: d2f4fb_
    complexed with mn

Details for d2f4fa1

PDB Entry: 2f4f (more details), 1.8 Å

PDB Description: Crystal structure of IS200 transposase
PDB Compounds: (A:) Transposase, putative

SCOPe Domain Sequences for d2f4fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4fa1 d.58.57.1 (A:2-131) Putative transposase SSO1474 {Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

SCOPe Domain Coordinates for d2f4fa1:

Click to download the PDB-style file with coordinates for d2f4fa1.
(The format of our PDB-style files is described here.)

Timeline for d2f4fa1: