Lineage for d2f4bb_ (2f4b B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342692Domain d2f4bb_: 2f4b B: [132919]
    automated match to d1fm6d_
    complexed with eha

Details for d2f4bb_

PDB Entry: 2f4b (more details), 2.07 Å

PDB Description: Crystal structure of the ligand binding domain of human PPAR-gamma in complex with an agonist
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2f4bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4bb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d2f4bb_:

Click to download the PDB-style file with coordinates for d2f4bb_.
(The format of our PDB-style files is described here.)

Timeline for d2f4bb_: