Lineage for d2f4ba_ (2f4b A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013036Domain d2f4ba_: 2f4b A: [132918]
    automated match to d1fm6d_
    complexed with eha

Details for d2f4ba_

PDB Entry: 2f4b (more details), 2.07 Å

PDB Description: Crystal structure of the ligand binding domain of human PPAR-gamma in complex with an agonist
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2f4ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4ba_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d2f4ba_:

Click to download the PDB-style file with coordinates for d2f4ba_.
(The format of our PDB-style files is described here.)

Timeline for d2f4ba_: