Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.89: Phosphofructokinase [53783] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest Domain 2 has parallel sheet of 4 strands, order 2314 |
Superfamily c.89.1: Phosphofructokinase [53784] (2 families) |
Family c.89.1.1: Phosphofructokinase [53785] (3 proteins) |
Protein automated matches [190282] (4 species) not a true protein |
Species Borrelia burgdorferi [TaxId:224326] [187082] (1 PDB entry) |
Domain d2f48b_: 2f48 B: [132916] automated match to d1kzhb_ complexed with af3, fbp |
PDB Entry: 2f48 (more details), 2.11 Å
SCOPe Domain Sequences for d2f48b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f48b_ c.89.1.1 (B:) automated matches {Borrelia burgdorferi [TaxId: 224326]} tslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfte gesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendk ielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntna ailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstk kywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslng dnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgv ylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpv dhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvpl tmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseiv deitetlklelf
Timeline for d2f48b_: