Lineage for d2f48a_ (2f48 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142778Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2142779Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2142780Family c.89.1.1: Phosphofructokinase [53785] (3 protein domains)
  6. 2142824Protein automated matches [190282] (2 species)
    not a true protein
  7. 2142828Species Borrelia burgdorferi [TaxId:224326] [187082] (1 PDB entry)
  8. 2142829Domain d2f48a_: 2f48 A: [132915]
    automated match to d1kzhb_
    complexed with af3, fbp

Details for d2f48a_

PDB Entry: 2f48 (more details), 2.11 Å

PDB Description: Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
PDB Compounds: (A:) diphosphate--fructose-6-phosphate 1-phosphotransferase

SCOPe Domain Sequences for d2f48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f48a_ c.89.1.1 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
eitetlklelf

SCOPe Domain Coordinates for d2f48a_:

Click to download the PDB-style file with coordinates for d2f48a_.
(The format of our PDB-style files is described here.)

Timeline for d2f48a_: