Lineage for d2f44b_ (2f44 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272256Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)
  7. 1272257Species Norway rat (Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)
    Uniprot Q9JLU4 1749-1815
  8. 1272262Domain d2f44b_: 2f44 B: [132912]
    automated match to d2f3na1
    complexed with cl, zn

Details for d2f44b_

PDB Entry: 2f44 (more details), 2.4 Å

PDB Description: crystal structure of the zinc-bound shank sam domain
PDB Compounds: (B:) SH3 and multiple ankyrin repeat domains 3

SCOPe Domain Sequences for d2f44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f44b_ a.60.1.2 (B:) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lrql

SCOPe Domain Coordinates for d2f44b_:

Click to download the PDB-style file with coordinates for d2f44b_.
(The format of our PDB-style files is described here.)

Timeline for d2f44b_: