Lineage for d2f43b3 (2f43 B:82-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1364615Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1364726Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1364793Species Norway rat (Rattus norvegicus) [TaxId:10116] [88781] (2 PDB entries)
  8. 1364795Domain d2f43b3: 2f43 B:82-357 [132910]
    Other proteins in same PDB: d2f43a1, d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43g1
    automatically matched to d1mabb3
    complexed with adp, atp, mg, vo4

Details for d2f43b3

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (B:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2f43b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f43b3 c.37.1.11 (B:82-357) Central domain of beta subunit of F1 ATP synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2f43b3:

Click to download the PDB-style file with coordinates for d2f43b3.
(The format of our PDB-style files is described here.)

Timeline for d2f43b3: