Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88781] (2 PDB entries) |
Domain d2f43b3: 2f43 B:82-357 [132910] Other proteins in same PDB: d2f43a1, d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43g1 automatically matched to d1mabb3 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f43b3 c.37.1.11 (B:82-357) Central domain of beta subunit of F1 ATP synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]} ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d2f43b3:
View in 3D Domains from other chains: (mouse over for more information) d2f43a1, d2f43a2, d2f43a3, d2f43g1 |