![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Domain d2f43b1: 2f43 B:358-477 [132908] Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b2, d2f43b3, d2f43g1 automated match to d1mabb1 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43b1:
Sequence, based on SEQRES records: (download)
>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseerarkiqrflsqpfqvaev ftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
Timeline for d2f43b1:
![]() Domains from other chains: (mouse over for more information) d2f43a1, d2f43a2, d2f43a3, d2f43g1 |