Lineage for d2f41d1 (2f41 D:73-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721568Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)
  6. 721686Protein Transcription factor FapR, C-terminal domain [143184] (1 species)
  7. 721687Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
  8. 721691Domain d2f41d1: 2f41 D:73-183 [132907]
    automatically matched to 2F41 A:73-183

Details for d2f41d1

PDB Entry: 2f41 (more details), 2.5 Å

PDB Description: Crystal structure of FapR- a global regulator of fatty acid biosynthesis in B. subtilis
PDB Compounds: (D:) Transcription factor fapR

SCOP Domain Sequences for d2f41d1:

Sequence, based on SEQRES records: (download)

>d2f41d1 d.38.1.5 (D:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddelaltasa
dirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy

Sequence, based on observed residues (ATOM records): (download)

>d2f41d1 d.38.1.5 (D:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavilaltasadir
ftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy

SCOP Domain Coordinates for d2f41d1:

Click to download the PDB-style file with coordinates for d2f41d1.
(The format of our PDB-style files is described here.)

Timeline for d2f41d1: