SCOP 1.75: Domain d2f41c1: 2f41 C:73-183

Lineage for d2f41c1 (2f41 C:73-183)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)

6. Protein Transcription factor FapR, C-terminal domain [143184] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
   Uniprot O34835 66-186! Uniprot O34835 73-183

8. Domain d2f41c1: 2f41 C:73-183 [132906]
   automatically matched to 2F41 A:73-183

Details for d2f41c1

PDB Entry: 2f41, 2.5 Å

PDB Description: Crystal structure of FapR- a global regulator of fatty acid biosynthesis in B. subtilis

PDB Compounds: (C:) Transcription factor fapR

SCOP Domain Sequences for d2f41c1:

Sequence, based on SEQRES records:

>d2f41c1 d.38.1.5 (C:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddelaltasa
dirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy

Sequence, based on observed residues (ATOM records):

>d2f41c1 d.38.1.5 (C:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvarghhlfaqanslavavilaltasadirftrqvk
qgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmy

Timeline for d2f41c1:

• d2f41c1 first appeared in SCOP 1.73
  
• d2f41c1 is called d2f41c_ in SCOPe 2.01
  
• d2f41c1 appears in the current release, SCOPe 2.08, called d2f41c_