SCOPe 2.07: Domain d2f40a1: 2f40 A:2-74

Lineage for d2f40a1 (2f40 A:2-74)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily)

4. Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family)

5. Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins)
   this is not a true family

6. Protein Hypothetical protein PF1455 [144310] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [144311] (1 PDB entry)
   Uniprot Q8U0X6 2-74

8. Domain d2f40a1: 2f40 A:2-74 [132903]
   Other proteins in same PDB: d2f40a2
   consistent with the InterPro (SF) assignment to HMA domain-like superfamily (55008) of the Ferredoxin-like fold (54861), but does not contain the conserved metal-binding residue

Details for d2f40a1

PDB Entry: 2f40

PDB Description: Structure of a Novel Protein from Backbone-Centered NMR Data and NMR-Assisted Structure Prediction

PDB Compounds: (A:) hypothetical protein PF1455

SCOPe Domain Sequences for d2f40a1:

Sequence; same for both SEQRES and ATOM records:

>d2f40a1 i.11.1.1 (A:2-74) Hypothetical protein PF1455 {Pyrococcus furiosus [TaxId: 2261]}
kwikfttnltpeeakivqyelstrdefyrvfinpyakvaevviddskvnieelkeklkge
vieekeitlqeli

Timeline for d2f40a1:

• d2f40a1 first appeared in SCOP 1.73
  
• d2f40a1 appears in SCOPe 2.06
  
• d2f40a1 appears in the current release, SCOPe 2.08