![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily) |
![]() | Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family) ![]() |
![]() | Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins) this is not a true family |
![]() | Protein Hypothetical protein PF1455 [144310] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [144311] (1 PDB entry) Uniprot Q8U0X6 2-74 |
![]() | Domain d2f40a1: 2f40 A:2-74 [132903] Other proteins in same PDB: d2f40a2 consistent with the InterPro (SF) assignment to HMA domain-like superfamily (55008) of the Ferredoxin-like fold (54861), but does not contain the conserved metal-binding residue |
PDB Entry: 2f40 (more details)
SCOPe Domain Sequences for d2f40a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f40a1 i.11.1.1 (A:2-74) Hypothetical protein PF1455 {Pyrococcus furiosus [TaxId: 2261]} kwikfttnltpeeakivqyelstrdefyrvfinpyakvaevviddskvnieelkeklkge vieekeitlqeli
Timeline for d2f40a1: