Lineage for d2f3xb1 (2f3x B:66-186)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943957Protein Transcription factor FapR, C-terminal domain [143184] (1 species)
  7. 2943958Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
    Uniprot O34835 66-186! Uniprot O34835 73-183
  8. 2943964Domain d2f3xb1: 2f3x B:66-186 [132902]
    automatically matched to 2F3X A:66-186
    complexed with mlc

Details for d2f3xb1

PDB Entry: 2f3x (more details), 3.1 Å

PDB Description: Crystal structure of FapR (in complex with effector)- a global regulator of fatty acid biosynthesis in B. subtilis
PDB Compounds: (B:) Transcription factor fapR

SCOPe Domain Sequences for d2f3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3xb1 d.38.1.5 (B:66-186) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
vkslsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavidde
laltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrs
k

SCOPe Domain Coordinates for d2f3xb1:

Click to download the PDB-style file with coordinates for d2f3xb1.
(The format of our PDB-style files is described here.)

Timeline for d2f3xb1: