SCOPe 2.08: Domain d2f3xb1: 2f3x B:66-186

Lineage for d2f3xb1 (2f3x B:66-186)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Transcription factor FapR, C-terminal domain [143184] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
   Uniprot O34835 66-186! Uniprot O34835 73-183

8. Domain d2f3xb1: 2f3x B:66-186 [132902]
   automatically matched to 2F3X A:66-186
   complexed with mlc

Details for d2f3xb1

PDB Entry: 2f3x, 3.1 Å

PDB Description: Crystal structure of FapR (in complex with effector)- a global regulator of fatty acid biosynthesis in B. subtilis

PDB Compounds: (B:) Transcription factor fapR

SCOPe Domain Sequences for d2f3xb1:

Sequence; same for both SEQRES and ATOM records:

>d2f3xb1 d.38.1.5 (B:66-186) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
vkslsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavidde
laltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrs
k

Timeline for d2f3xb1:

• d2f3xb1 first appeared in SCOP 1.73
  
• d2f3xb1 appears in SCOPe 2.07