SCOP 1.73: Domain d2f3xa1: 2f3x A:66-186

Lineage for d2f3xa1 (2f3x A:66-186)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins)

6. Protein Transcription factor FapR, C-terminal domain [143184] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)

8. Domain d2f3xa1: 2f3x A:66-186 [132901]
   complexed with mlc

Details for d2f3xa1

PDB Entry: 2f3x, 3.1 Å

PDB Description: Crystal structure of FapR (in complex with effector)- a global regulator of fatty acid biosynthesis in B. subtilis

PDB Compounds: (A:) Transcription factor fapR

SCOP Domain Sequences for d2f3xa1:

Sequence; same for both SEQRES and ATOM records:

>d2f3xa1 d.38.1.5 (A:66-186) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
vkslsldevigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavavidde
laltasadirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyrs
k

Timeline for d2f3xa1:

• d2f3xa1 is new in SCOP 1.73
  
• d2f3xa1 appears in SCOP 1.75
  
• d2f3xa1 appears in the current release, SCOPe 2.08