Lineage for d2f3wa_ (2f3w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2787873Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2787874Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2787875Protein Staphylococcal nuclease [50201] (1 species)
  7. 2787876Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries)
    Uniprot P00644 89-223
  8. 2788151Domain d2f3wa_: 2f3w A: [132900]
    automated match to d2f3wa1

Details for d2f3wa_

PDB Entry: 2f3w (more details)

PDB Description: solution structure of 1-110 fragment of staphylococcal nuclease in 2m tmao
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d2f3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3wa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglak

SCOPe Domain Coordinates for d2f3wa_:

Click to download the PDB-style file with coordinates for d2f3wa_.
(The format of our PDB-style files is described here.)

Timeline for d2f3wa_: