SCOPe 2.06: Domain d2f3tf_: 2f3t F:

Lineage for d2f3tf_ (2f3t F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (5 species)

7. Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)

8. Domain d2f3tf_: 2f3t F: [132898]
   automated match to d2anba_
   complexed with lgp

Details for d2f3tf_

PDB Entry: 2f3t, 3.16 Å

PDB Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ganciclovir monophosphate

PDB Compounds: (F:) Guanylate kinase

SCOPe Domain Sequences for d2f3tf_:

Sequence; same for both SEQRES and ATOM records:

>d2f3tf_ c.37.1.1 (F:) Guanylate kinase {Escherichia coli [TaxId: 562]}
aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
iiraerlrmsrqkqrhdalisklla

Timeline for d2f3tf_:

• d2f3tf_ first appeared in SCOP 1.73, called d2f3tf1
  
• d2f3tf_ appears in SCOPe 2.05
  
• d2f3tf_ appears in SCOPe 2.07
  
• d2f3tf_ appears in the current release, SCOPe 2.08