Lineage for d2f3tf_ (2f3t F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593811Protein Guanylate kinase [52542] (5 species)
  7. 1593820Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 1593839Domain d2f3tf_: 2f3t F: [132898]
    automated match to d2anba_
    complexed with lgp

Details for d2f3tf_

PDB Entry: 2f3t (more details), 3.16 Å

PDB Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ganciclovir monophosphate
PDB Compounds: (F:) Guanylate kinase

SCOPe Domain Sequences for d2f3tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3tf_ c.37.1.1 (F:) Guanylate kinase {Escherichia coli [TaxId: 562]}
aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
iiraerlrmsrqkqrhdalisklla

SCOPe Domain Coordinates for d2f3tf_:

Click to download the PDB-style file with coordinates for d2f3tf_.
(The format of our PDB-style files is described here.)

Timeline for d2f3tf_: