SCOP 1.73: Domain d2f3tf1: 2f3t F:3-206

Lineage for d2f3tf1 (2f3t F:3-206)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase [52542] (4 species)

7. Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)

8. Domain d2f3tf1: 2f3t F:3-206 [132898]
   automatically matched to d1s96a_
   complexed with lgp

Details for d2f3tf1

PDB Entry: 2f3t, 3.16 Å

PDB Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ganciclovir monophosphate

PDB Compounds: (F:) Guanylate kinase

SCOP Domain Sequences for d2f3tf1:

Sequence; same for both SEQRES and ATOM records:

>d2f3tf1 c.37.1.1 (F:3-206) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdalisklla

Timeline for d2f3tf1:

• d2f3tf1 is new in SCOP 1.73
  
• d2f3tf1 appears in SCOP 1.75
  
• d2f3tf1 appears in the current release, SCOPe 2.08, called d2f3tf_