![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Guanylate kinase [52542] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [102338] (6 PDB entries) |
![]() | Domain d2f3te_: 2f3t E: [132897] automated match to d2anba_ complexed with lgp |
PDB Entry: 2f3t (more details), 3.16 Å
SCOPe Domain Sequences for d2f3te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3te_ c.37.1.1 (E:) Guanylate kinase {Escherichia coli [TaxId: 562]} aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt iiraerlrmsrqkqrhdaliskll
Timeline for d2f3te_: