Lineage for d2f3rb1 (2f3r B:3-204)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695228Protein Guanylate kinase [52542] (4 species)
  7. 695234Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 695240Domain d2f3rb1: 2f3r B:3-204 [132891]
    automatically matched to d1s96a_
    complexed with g5p

Details for d2f3rb1

PDB Entry: 2f3r (more details), 2.5 Å

PDB Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ap5G
PDB Compounds: (B:) Guanylate kinase

SCOP Domain Sequences for d2f3rb1:

Sequence, based on SEQRES records: (download)

>d2f3rb1 c.37.1.1 (B:3-204) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdaliskl

Sequence, based on observed residues (ATOM records): (download)

>d2f3rb1 c.37.1.1 (B:3-204) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgseeviakrmaqavaemshyaeydylivnddfdtaltdlktiirae
rlrmsrqkqrhdaliskl

SCOP Domain Coordinates for d2f3rb1:

Click to download the PDB-style file with coordinates for d2f3rb1.
(The format of our PDB-style files is described here.)

Timeline for d2f3rb1:

Domains from other chains:
(mouse over for more information)
d2f3ra1