Lineage for d2f3rb_ (2f3r B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109494Protein Guanylate kinase [52542] (5 species)
  7. 2109510Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 2109516Domain d2f3rb_: 2f3r B: [132891]
    automated match to d1s96a_
    complexed with g5p

Details for d2f3rb_

PDB Entry: 2f3r (more details), 2.5 Å

PDB Description: Crystal Structure Of E.coli Guanylate Kinase In Complex With Ap5G
PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d2f3rb_:

Sequence, based on SEQRES records: (download)

>d2f3rb_ c.37.1.1 (B:) Guanylate kinase {Escherichia coli [TaxId: 562]}
aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
filppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkt
iiraerlrmsrqkqrhdaliskl

Sequence, based on observed residues (ATOM records): (download)

>d2f3rb_ c.37.1.1 (B:) Guanylate kinase {Escherichia coli [TaxId: 562]}
aqgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhde
fkemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsi
filppskieldrrlrgseeviakrmaqavaemshyaeydylivnddfdtaltdlktiira
erlrmsrqkqrhdaliskl

SCOPe Domain Coordinates for d2f3rb_:

Click to download the PDB-style file with coordinates for d2f3rb_.
(The format of our PDB-style files is described here.)

Timeline for d2f3rb_: