SCOP 1.75: Domain d2f3nb1: 2f3n B:2-65

Lineage for d2f3nb1 (2f3n B:2-65)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (3 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)

7. Species Rat(Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)
   Uniprot Q9JLU4 1749-1815

8. Domain d2f3nb1: 2f3n B:2-65 [132886]
   automatically matched to 2F3N A:2-65
   mutant

Details for d2f3nb1

PDB Entry: 2f3n, 2.1 Å

PDB Description: crystal structure of the native shank sam domain.

PDB Compounds: (B:) SH3 and multiple ankyrin repeat domains 3

SCOP Domain Sequences for d2f3nb1:

Sequence; same for both SEQRES and ATOM records:

>d2f3nb1 a.60.1.2 (B:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lrql

Timeline for d2f3nb1:

• d2f3nb1 first appeared in SCOP 1.73
  
• d2f3nb1 is called d2f3nb_ in SCOPe 2.01
  
• d2f3nb1 appears in the current release, SCOPe 2.08, called d2f3nb_