Lineage for d2f3nb_ (2f3n B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715529Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species)
  7. 2715530Species Norway rat (Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries)
    Uniprot Q9JLU4 1749-1815
  8. 2715532Domain d2f3nb_: 2f3n B: [132886]
    automated match to d2f3na1

Details for d2f3nb_

PDB Entry: 2f3n (more details), 2.1 Å

PDB Description: crystal structure of the native shank sam domain.
PDB Compounds: (B:) SH3 and multiple ankyrin repeat domains 3

SCOPe Domain Sequences for d2f3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3nb_ a.60.1.2 (B:) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghreniera
lrql

SCOPe Domain Coordinates for d2f3nb_:

Click to download the PDB-style file with coordinates for d2f3nb_.
(The format of our PDB-style files is described here.)

Timeline for d2f3nb_: