Class a: All alpha proteins [46456] (258 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries) |
Domain d2f3md1: 2f3m D:85-217 [132879] Other proteins in same PDB: d2f3ma2, d2f3mb2, d2f3mc2, d2f3md2, d2f3me2, d2f3mf2 automatically matched to d1gtua1 complexed with gtd |
PDB Entry: 2f3m (more details), 2.7 Å
SCOP Domain Sequences for d2f3md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3md1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp rpvfskmavwgnk
Timeline for d2f3md1: