![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
![]() | Protein Class mu GST [81359] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries) |
![]() | Domain d2f3mc2: 2f3m C:1-84 [132878] Other proteins in same PDB: d2f3ma1, d2f3mb1, d2f3mc1, d2f3md1, d2f3me1, d2f3mf1 automatically matched to d1gtua2 complexed with gtd |
PDB Entry: 2f3m (more details), 2.7 Å
SCOP Domain Sequences for d2f3mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3mc2 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d2f3mc2: