SCOPe 2.05: Domain d2f3ce_: 2f3c E:

Lineage for d2f3ce_ (2f3c E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d2f3ce_: 2f3c E: [132862]
   Other proteins in same PDB: d2f3ci1
   automated match to d1aq7__
   complexed with ca, so4

Details for d2f3ce_

PDB Entry: 2f3c, 2.5 Å

PDB Description: crystal structure of infestin 1, a kazal-type serineprotease inhibitor, in complex with trypsin

PDB Compounds: (E:) cationic trypsin

SCOPe Domain Sequences for d2f3ce_:

Sequence, based on SEQRES records:

>d2f3ce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records):

>d2f3ce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnvasislptscasagtqclisgwg
ntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvv
csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2f3ce_:

• d2f3ce_ first appeared in SCOP 1.73, called d2f3ce1
  
• d2f3ce_ appears in SCOPe 2.04
  
• d2f3ce_ appears in SCOPe 2.06
  
• d2f3ce_ appears in the current release, SCOPe 2.08