Lineage for d2f3ce1 (2f3c E:16-238)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803036Protein Trypsin(ogen) [50515] (9 species)
  7. 803037Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
    Uniprot P00760
  8. 803312Domain d2f3ce1: 2f3c E:16-238 [132862]
    Other proteins in same PDB: d2f3ci1
    automatically matched to d1tgsz_
    complexed with ca, so4

Details for d2f3ce1

PDB Entry: 2f3c (more details), 2.5 Å

PDB Description: crystal structure of infestin 1, a kazal-type serineprotease inhibitor, in complex with trypsin
PDB Compounds: (E:) cationic trypsin

SCOP Domain Sequences for d2f3ce1:

Sequence, based on SEQRES records: (download)

>d2f3ce1 b.47.1.2 (E:16-238) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d2f3ce1 b.47.1.2 (E:16-238) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnvasislptscasagtqclisgwg
ntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvv
csgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d2f3ce1:

Click to download the PDB-style file with coordinates for d2f3ce1.
(The format of our PDB-style files is described here.)

Timeline for d2f3ce1: