SCOPe 2.08: Domain d2f3ba_: 2f3b A:

Lineage for d2f3ba_ (2f3b A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)

6. Protein automated matches [190281] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [187081] (2 PDB entries)

8. Domain d2f3ba_: 2f3b A: [132861]
   automated match to d1fsaa_
   complexed with f6p, po4, zn

Details for d2f3ba_

PDB Entry: 2f3b, 1.8 Å

PDB Description: mechanism of displacement of a catalytically essential loop from the active site of fructose-1,6-bisphosphatase

PDB Compounds: (A:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d2f3ba_:

Sequence; same for both SEQRES and ATOM records:

>d2f3ba_ e.7.1.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dvtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdq
vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl
vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa
igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv
advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd
ihqrapiilgspedvtelleiyqkha

Timeline for d2f3ba_:

• d2f3ba_ first appeared in SCOP 1.73, called d2f3ba1
  
• d2f3ba_ appears in SCOPe 2.07