![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
![]() | Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) ![]() |
![]() | Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) |
![]() | Protein automated matches [190281] (5 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [187081] (2 PDB entries) |
![]() | Domain d2f3ba_: 2f3b A: [132861] automated match to d1fsaa_ complexed with f6p, po4, zn |
PDB Entry: 2f3b (more details), 1.8 Å
SCOPe Domain Sequences for d2f3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3ba_ e.7.1.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dvtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdq vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd ihqrapiilgspedvtelleiyqkha
Timeline for d2f3ba_: