Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [50059] (21 PDB entries) |
Domain d2f2va1: 2f2v A:4-62 [132849] automatically matched to d1pwt__ complexed with fmt; mutant |
PDB Entry: 2f2v (more details), 1.85 Å
SCOP Domain Sequences for d2f2va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2va1 b.34.2.1 (A:4-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} tgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpagyvkkld
Timeline for d2f2va1: