Lineage for d2f2tb1 (2f2t B:9-160)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692695Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (3 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 692696Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 692697Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 692703Species Trypanosoma brucei [TaxId:5691] [142064] (5 PDB entries)
  8. 692711Domain d2f2tb1: 2f2t B:9-160 [132848]
    automatically matched to 2A0K A:9-160
    complexed with 5iq, gol, so4; mutant

Details for d2f2tb1

PDB Entry: 2f2t (more details), 1.7 Å

PDB Description: Crystal structure of Nucleoside 2-deoxyribosyltransferase from Trypanosoma brucei at 1.7 A resolution with 5-Aminoisoquinoline bound
PDB Compounds: (B:) nucleoside 2-deoxyribosyltransferase

SCOP Domain Sequences for d2f2tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2tb1 c.23.14.1 (B:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]}
mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc
daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg
fglpfnlmlydgvevfdsfesafkyflanfps

SCOP Domain Coordinates for d2f2tb1:

Click to download the PDB-style file with coordinates for d2f2tb1.
(The format of our PDB-style files is described here.)

Timeline for d2f2tb1: