| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
| Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins) |
| Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species) class II N-deoxyribosyltransferase |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142064] (5 PDB entries) Uniprot Q57VC7 1-152 |
| Domain d2f2ta2: 2f2t A:9-160 [132847] Other proteins in same PDB: d2f2ta3, d2f2tb3 automated match to d2a0ka1 complexed with 5iq, gol, so4 |
PDB Entry: 2f2t (more details), 1.7 Å
SCOPe Domain Sequences for d2f2ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ta2 c.23.14.1 (A:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc
daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg
fglpfnlmlydgvevfdsfesafkyflanfps
Timeline for d2f2ta2: