![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein Peptidoglycan-recognition protein-LC [143784] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143785] (2 PDB entries) Uniprot Q9GNK5 335-499! Uniprot Q9GNK5 355-520 Cg4432; different splicing isoforms |
![]() | Domain d2f2lx1: 2f2l X:335-499 [132844] Other proteins in same PDB: d2f2la2, d2f2la3, d2f2lx2 complexed with cit, hsq, mld, nag, so4 |
PDB Entry: 2f2l (more details), 2.1 Å
SCOPe Domain Sequences for d2f2lx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2lx1 d.118.1.1 (X:335-499) Peptidoglycan-recognition protein-LC {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswgw dhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacqll lqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshe
Timeline for d2f2lx1: