Lineage for d2f2lx1 (2f2l X:335-499)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579414Protein Peptidoglycan-recognition protein-LC [143784] (1 species)
  7. 2579415Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143785] (2 PDB entries)
    Uniprot Q9GNK5 335-499! Uniprot Q9GNK5 355-520
    Cg4432; different splicing isoforms
  8. 2579416Domain d2f2lx1: 2f2l X:335-499 [132844]
    Other proteins in same PDB: d2f2la2, d2f2la3, d2f2lx2
    complexed with cit, hsq, mld, nag, so4

Details for d2f2lx1

PDB Entry: 2f2l (more details), 2.1 Å

PDB Description: crystal structure of tracheal cytotoxin (tct) bound to the ectodomain complex of peptidoglycan recognition proteins lca (pgrp-lca) and lcx (pgrp-lcx)
PDB Compounds: (X:) Peptidoglycan recognition protein-LC isoform LCx

SCOPe Domain Sequences for d2f2lx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2lx1 d.118.1.1 (X:335-499) Peptidoglycan-recognition protein-LC {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswgw
dhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacqll
lqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshe

SCOPe Domain Coordinates for d2f2lx1:

Click to download the PDB-style file with coordinates for d2f2lx1.
(The format of our PDB-style files is described here.)

Timeline for d2f2lx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f2lx2