SCOP 1.75: Domain d2f2lx1: 2f2l X:335-499

Lineage for d2f2lx1 (2f2l X:335-499)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (10 proteins)
   Family 2 zinc amidase;

6. Protein Peptidoglycan-recognition protein-LC [143784] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143785] (2 PDB entries)
   Uniprot Q9GNK5 335-499! Uniprot Q9GNK5 355-520
   Cg4432; different splicing isoforms

8. Domain d2f2lx1: 2f2l X:335-499 [132844]
   complexed with cit, mld, nag, so4

Details for d2f2lx1

PDB Entry: 2f2l, 2.1 Å

PDB Description: crystal structure of tracheal cytotoxin (tct) bound to the ectodomain complex of peptidoglycan recognition proteins lca (pgrp-lca) and lcx (pgrp-lcx)

PDB Compounds: (X:) Peptidoglycan recognition protein-LC isoform LCx

SCOP Domain Sequences for d2f2lx1:

Sequence; same for both SEQRES and ATOM records:

>d2f2lx1 d.118.1.1 (X:335-499) Peptidoglycan-recognition protein-LC {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vilkvaewggrpakrmldaqqlpinrvvishtaaegcesrevcsarvnvvqsfhmdswgw
dhigynflvggdgrvyegrgwdyvgahtkgynrgsigisfigtfttrkpnerqleacqll
lqegvrlkklttnyrlyghrqlsatespgeelykiikkwphwshe

Timeline for d2f2lx1:

• d2f2lx1 first appeared in SCOP 1.73
  
• d2f2lx1 appears in SCOPe 2.01
  
• d2f2lx1 appears in the current release, SCOPe 2.08