Lineage for d2f2la2 (2f2l A:355-520)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579603Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2579604Protein automated matches [190280] (9 species)
    not a true protein
  7. 2579626Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187079] (3 PDB entries)
  8. 2579630Domain d2f2la2: 2f2l A:355-520 [132843]
    Other proteins in same PDB: d2f2la3, d2f2lx1, d2f2lx2
    automated match to d1sk4a_
    complexed with cit, hsq, mld, nag, so4

Details for d2f2la2

PDB Entry: 2f2l (more details), 2.1 Å

PDB Description: crystal structure of tracheal cytotoxin (tct) bound to the ectodomain complex of peptidoglycan recognition proteins lca (pgrp-lca) and lcx (pgrp-lcx)
PDB Compounds: (A:) Peptidoglycan-recognition protein-LC isoform LCa

SCOPe Domain Sequences for d2f2la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2la2 d.118.1.0 (A:355-520) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqkc
diaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtrl
llergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws

SCOPe Domain Coordinates for d2f2la2:

Click to download the PDB-style file with coordinates for d2f2la2.
(The format of our PDB-style files is described here.)

Timeline for d2f2la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f2la3