Lineage for d2f2la1 (2f2l A:355-520)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732422Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 732423Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (1 family) (S)
  5. 732424Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (10 proteins)
    Family 2 zinc amidase;
  6. 732453Protein Peptidoglycan-recognition protein-LC [143784] (1 species)
  7. 732454Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [143785] (2 PDB entries)
    Cg4432; different splicing isoforms
  8. 732455Domain d2f2la1: 2f2l A:355-520 [132843]
    automatically matched to 1Z6I A:355-520
    complexed with cit, mld, nag, so4

Details for d2f2la1

PDB Entry: 2f2l (more details), 2.1 Å

PDB Description: crystal structure of tracheal cytotoxin (tct) bound to the ectodomain complex of peptidoglycan recognition proteins lca (pgrp-lca) and lcx (pgrp-lcx)
PDB Compounds: (A:) Peptidoglycan-recognition protein-LC isoform LCa

SCOP Domain Sequences for d2f2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2la1 d.118.1.1 (A:355-520) Peptidoglycan-recognition protein-LC {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
fverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqkc
diaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtrl
llergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws

SCOP Domain Coordinates for d2f2la1:

Click to download the PDB-style file with coordinates for d2f2la1.
(The format of our PDB-style files is described here.)

Timeline for d2f2la1: