Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
Protein automated matches [190280] (10 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187079] (3 PDB entries) |
Domain d2f2la2: 2f2l A:355-520 [132843] Other proteins in same PDB: d2f2la3, d2f2lx1, d2f2lx2 automated match to d1sk4a_ complexed with cit, hsq, mld, nag, so4 |
PDB Entry: 2f2l (more details), 2.1 Å
SCOPe Domain Sequences for d2f2la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2la2 d.118.1.0 (A:355-520) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} fverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqkc diaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtrl llergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws
Timeline for d2f2la2: