Lineage for d2f2he2 (2f2h E:1-247)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664821Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins)
  6. 664825Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 664826Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
  8. 664831Domain d2f2he2: 2f2h E:1-247 [132835]
    Other proteins in same PDB: d2f2ha1, d2f2ha3, d2f2ha4, d2f2hb1, d2f2hb3, d2f2hb4, d2f2hc1, d2f2hc3, d2f2hc4, d2f2hd1, d2f2hd3, d2f2hd4, d2f2he1, d2f2he3, d2f2he4, d2f2hf1, d2f2hf3, d2f2hf4
    automatically matched to 2F2H A:1-247
    complexed with gol, mpo, so4, xtg

Details for d2f2he2

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2he2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2he2 b.30.5.11 (E:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOP Domain Coordinates for d2f2he2:

Click to download the PDB-style file with coordinates for d2f2he2.
(The format of our PDB-style files is described here.)

Timeline for d2f2he2: