SCOPe 2.07: Domain d2f2hd3: 2f2h D:586-665

Lineage for d2f2hd3 (2f2h D:586-665)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)

6. Protein Putative glucosidase YicI, domain 3 [117299] (1 species)

7. Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
   Uniprot P31434

8. Domain d2f2hd3: 2f2h D:586-665 [132832]
   Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha4, d2f2ha5, d2f2hb1, d2f2hb2, d2f2hb4, d2f2hb5, d2f2hc1, d2f2hc2, d2f2hc4, d2f2hc5, d2f2hd1, d2f2hd2, d2f2hd4, d2f2hd5, d2f2he1, d2f2he2, d2f2he4, d2f2he5, d2f2hf1, d2f2hf2, d2f2hf4, d2f2hf5
   automated match to d2f2ha3
   complexed with gol, mpo, so4, xtg

Details for d2f2hd3

PDB Entry: 2f2h, 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex

PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d2f2hd3:

Sequence; same for both SEQRES and ATOM records:

>d2f2hd3 b.71.1.4 (D:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

Timeline for d2f2hd3:

• d2f2hd3 first appeared in SCOP 1.73
  
• d2f2hd3 appears in SCOPe 2.06
  
• d2f2hd3 appears in the current release, SCOPe 2.08