| Class b: All beta proteins [48724] (165 folds) |
| Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) ![]() |
| Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein) |
| Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
| Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) |
| Domain d2f2hd1: 2f2h D:666-773 [132830] Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hd2, d2f2hd3, d2f2hd4, d2f2he2, d2f2he3, d2f2he4, d2f2hf2, d2f2hf3, d2f2hf4 automatically matched to 2F2H A:666-773 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOP Domain Sequences for d2f2hd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hd1 b.150.1.1 (D:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
Timeline for d2f2hd1: