SCOP 1.73: Domain d2f2hc1: 2f2h C:666-773

Lineage for d2f2hc1 (2f2h C:666-773)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)

8. Domain d2f2hc1: 2f2h C:666-773 [132826]
   Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hd2, d2f2hd3, d2f2hd4, d2f2he2, d2f2he3, d2f2he4, d2f2hf2, d2f2hf3, d2f2hf4
   automatically matched to 2F2H A:666-773
   complexed with gol, mpo, so4, xtg

Details for d2f2hc1

PDB Entry: 2f2h, 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex

PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2hc1:

Sequence; same for both SEQRES and ATOM records:

>d2f2hc1 b.150.1.1 (C:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

Timeline for d2f2hc1:

• d2f2hc1 is new in SCOP 1.73
  
• d2f2hc1 appears in SCOP 1.75
  
• d2f2hc1 appears in the current release, SCOPe 2.08