Lineage for d2f2hc1 (2f2h C:666-772)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825025Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2825026Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2825027Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (4 proteins)
  6. 2825058Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 2825059Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 2825062Domain d2f2hc1: 2f2h C:666-772 [132826]
    Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2ha5, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hb5, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hc5, d2f2hd2, d2f2hd3, d2f2hd4, d2f2hd5, d2f2he2, d2f2he3, d2f2he4, d2f2he5, d2f2hf2, d2f2hf3, d2f2hf4, d2f2hf5
    automated match to d2f2ha1
    complexed with gol, mpo, so4, xtg

Details for d2f2hc1

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d2f2hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2hc1 b.150.1.1 (C:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOPe Domain Coordinates for d2f2hc1:

Click to download the PDB-style file with coordinates for d2f2hc1.
(The format of our PDB-style files is described here.)

Timeline for d2f2hc1: