Lineage for d2f2hb4 (2f2h B:248-585)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816800Family c.1.8.13: YicI catalytic domain-like [117372] (2 proteins)
  6. 816804Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 816805Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 816807Domain d2f2hb4: 2f2h B:248-585 [132825]
    Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha3, d2f2hb1, d2f2hb2, d2f2hb3, d2f2hc1, d2f2hc2, d2f2hc3, d2f2hd1, d2f2hd2, d2f2hd3, d2f2he1, d2f2he2, d2f2he3, d2f2hf1, d2f2hf2, d2f2hf3
    automatically matched to 2F2H A:248-585
    complexed with gol, mpo, so4, xtg

Details for d2f2hb4

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2hb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2hb4 c.1.8.13 (B:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOP Domain Coordinates for d2f2hb4:

Click to download the PDB-style file with coordinates for d2f2hb4.
(The format of our PDB-style files is described here.)

Timeline for d2f2hb4: