![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins) |
![]() | Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
![]() | Domain d2f2hb3: 2f2h B:586-665 [132824] Other proteins in same PDB: d2f2ha1, d2f2ha2, d2f2ha4, d2f2ha5, d2f2hb1, d2f2hb2, d2f2hb4, d2f2hb5, d2f2hc1, d2f2hc2, d2f2hc4, d2f2hc5, d2f2hd1, d2f2hd2, d2f2hd4, d2f2hd5, d2f2he1, d2f2he2, d2f2he4, d2f2he5, d2f2hf1, d2f2hf2, d2f2hf4, d2f2hf5 automated match to d2f2ha3 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2hb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hb3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d2f2hb3:
![]() Domains from same chain: (mouse over for more information) d2f2hb1, d2f2hb2, d2f2hb4, d2f2hb5 |