| Class b: All beta proteins [48724] (174 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins) |
| Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
| Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
| Domain d2f2hb2: 2f2h B:1-247 [132823] Other proteins in same PDB: d2f2ha1, d2f2ha3, d2f2ha4, d2f2hb1, d2f2hb3, d2f2hb4, d2f2hc1, d2f2hc3, d2f2hc4, d2f2hd1, d2f2hd3, d2f2hd4, d2f2he1, d2f2he3, d2f2he4, d2f2hf1, d2f2hf3, d2f2hf4 automatically matched to 2F2H A:1-247 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOP Domain Sequences for d2f2hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2hb2 b.30.5.11 (B:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp
Timeline for d2f2hb2: