Lineage for d2f2ha1 (2f2h A:666-773)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813792Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 813793Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) (S)
  5. 813794Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)
  6. 813795Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 813796Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 813797Domain d2f2ha1: 2f2h A:666-773 [132818]
    Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hd2, d2f2hd3, d2f2hd4, d2f2he2, d2f2he3, d2f2he4, d2f2hf2, d2f2hf3, d2f2hf4
    complexed with gol, mpo, so4, xtg

Details for d2f2ha1

PDB Entry: 2f2h (more details), 1.95 Å

PDB Description: Structure of the YicI thiosugar Michaelis complex
PDB Compounds: (A:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d2f2ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ha1 b.150.1.1 (A:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

SCOP Domain Coordinates for d2f2ha1:

Click to download the PDB-style file with coordinates for d2f2ha1.
(The format of our PDB-style files is described here.)

Timeline for d2f2ha1: